SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001963 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001963
Domain Number 1 Region: 94-440
Classification Level Classification E-value
Superfamily Subtilisin-like 9.95e-82
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 434-580
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-43
Family Proprotein convertase P-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 11-82
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000000165
Family Prohormone convertase 1 pro-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001963   Gene: ENSECAG00000001142   Transcript: ENSECAT00000002741
Sequence length 619
Comment pep:known chromosome:EquCab2:22:7244148:7503670:-1 gene:ENSECAG00000001142 transcript:ENSECAT00000002741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFASAERPVFTNHFLVELHKGGEEEARQVAAEYGFGVRKLPFTEGLYHFYHNGLAKAKR
RRSLHHKQQLERDPRVKMALQQEGFNRKKRGYRDINEIDINMNDPLFTKQWYLINTGQAD
GTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPR
YTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMP
QLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC
DGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLR
HSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFN
HLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKEN
FVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHT
WGEDARGTWTLELGFVGSTPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEEL
EEELDEAVERSLKSILRNN
Download sequence
Identical sequences F6W2D5
ENSECAP00000001963 ENSECAP00000001963 9796.ENSECAP00000001963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]