SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002116 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002116
Domain Number - Region: 362-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00061
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0041
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 232-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00993
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 749-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family Laminin-type module 0.069
Further Details:      
 
Domain Number - Region: 142-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0572
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 446-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0706
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 627-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family Laminin-type module 0.07
Further Details:      
 
Domain Number - Region: 667-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0737
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002116   Gene: ENSECAG00000000706   Transcript: ENSECAT00000002954
Sequence length 1043
Comment pep:known chromosome:EquCab2:1:126342719:126562120:1 gene:ENSECAG00000000706 transcript:ENSECAT00000002954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSVTGLIGFSLLQTILSLNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCHHGAGCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGTFGFQCSQRCDCHNGGQCSPTTGVCECEPGYKGPRCQERLCPEGLHGPGCTS
PCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPAGYYGDGCQLPCTCQNGADCHSITG
SCACAPGFMGEVCAVPCAVGTYGPNCSSVCSCNNGGTCSPVDGSCTCKEGWQGVDCTHPC
PSGTWGLNCNESCICANGAACSPTDGSCSCTPGWLGDTCELPCPDGTFGLNCSERCDCSH
ADGCDPITGHCCCLSGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSGPCHHVSGICECLPGFSGALCNQVCAGGHFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGPACFHTCSCHNGASCSA
EDGACHCTPGWTGLFCTQRCPAAFYGKDCGRVCQCQNGASCDHISGKCTCRTGFTGRHCE
QRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSSGFKGIRCDQAALMMEELNPYTKISP
ALGVERHSVGAITGIVLLLFLIVVLLGLFAWRRRRKEKGRDVSPRVSYTPAMRMTSTDYS
LSGACGMDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPESS
YVEMKSPVHRGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGRGHNSSYIQNPYDLPKNSHI
PGHYDLLPVRQSPANGPSQDKQT
Download sequence
Identical sequences F6Y884
9796.ENSECAP00000002116 ENSECAP00000002116 ENSECAP00000002116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]