SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002168 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002168
Domain Number - Region: 42-76
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00183
Family Toll/Interleukin receptor TIR domain 0.0096
Further Details:      
 
Domain Number - Region: 73-166
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0229
Family Transforming growth factor (TGF)-beta 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002168   Gene: ENSECAG00000003167   Transcript: ENSECAT00000003027
Sequence length 168
Comment pep:known chromosome:EquCab2:30:4010033:4010539:1 gene:ENSECAG00000003167 transcript:ENSECAT00000003027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNTSERWQHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSC
AFCKPQRVTSVLVELDCPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Download sequence
Identical sequences F6XPS4
XP_001492621.2.31192 XP_005608003.1.31192 XP_005608004.1.31192 XP_005608005.1.31192 XP_008533280.1.77740 XP_008533281.1.77740 XP_008533282.1.77740 XP_008533283.1.77740 XP_008533284.1.77740 XP_008533285.1.77740 XP_008533286.1.77740 XP_008533287.1.77740 XP_008533288.1.77740 XP_014714414.1.49734 XP_014714415.1.49734 XP_014714417.1.49734 XP_014714418.1.49734 ENSECAP00000002168 9796.ENSECAP00000002168 ENSECAP00000002168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]