SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002277 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002277
Domain Number - Region: 2-64
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00259
Family Coiled-coil dimerization domain from cortexillin I 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002277   Gene: ENSECAG00000003341   Transcript: ENSECAT00000003194
Sequence length 227
Comment pep:known chromosome:EquCab2:X:83963095:83963775:1 gene:ENSECAG00000003341 transcript:ENSECAT00000003194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMKNTILEMRNSLEGLNSRVEEAEEWISELDERLEEITQAEQKREKRIRQNENSVRELWD
NIKRAVIWIIGVPEGEERDKGAENLFEEIIEENFPHLRKETDIQVQDAQRAPNKRSPKRP
TPRHIIIKMSKIKDKERILKAARERSQVTYKGKPIRLSADFSVKTLQARREWHDIFEVLK
GKNLQPRILYPSRLSFRMEGEINSFPDKKKLKEFITKKPVLQEMLKG
Download sequence
Identical sequences F6X164
9796.ENSECAP00000002277 ENSECAP00000002277 ENSECAP00000002277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]