SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002368 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002368
Domain Number 1 Region: 29-254
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.65e-72
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.000000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002368   Gene: ENSECAG00000002621   Transcript: ENSECAT00000003338
Sequence length 254
Comment pep:known chromosome:EquCab2:12:24333118:24339205:1 gene:ENSECAG00000002621 transcript:ENSECAT00000003338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHK
KYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIED
FHNTFMDLIEQVEKRTSVADLLASFNDQSTSDYLVVYLRLLTSGHLQRESTFFEHFIEGG
RTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKV
YLLYRPGHYDILYK
Download sequence
Identical sequences F6YLB4
9796.ENSECAP00000002368 ENSECAP00000002368 ENSECAP00000002368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]