SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002419 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002419
Domain Number 1 Region: 4-41
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000103
Family TB module/8-cys domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002419   Gene: ENSECAG00000003580   Transcript: ENSECAT00000003412
Sequence length 64
Comment pep:known chromosome:EquCab2:Un0231:1136:1327:-1 gene:ENSECAG00000003580 transcript:ENSECAT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGGVCWLQQGREATCSLVLKTDVSQAECCASGNIDTAWSNFTHPGNKISLLGFLGLVHC
LPCK
Download sequence
Identical sequences H9GZQ6
ENSECAP00000002419 ENSECAP00000002419 9796.ENSECAP00000002419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]