SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002476 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002476
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 9.8e-80
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000887
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-24
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002476   Gene: ENSECAG00000003664   Transcript: ENSECAT00000003504
Sequence length 429
Comment pep:known chromosome:EquCab2:11:61235320:61236609:1 gene:ENSECAG00000003664 transcript:ENSECAT00000003504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAGRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDVRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPPEGHGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAR
DLVENKFLLPSANSFCYENELAFLSRDEEDEADADQDGPSPQARHDFDRAQAGIGGTLEQ
RPYRRESEI
Download sequence
Identical sequences F6XH91
9796.ENSECAP00000002476 ENSECAP00000002476 ENSECAP00000002476 XP_005597914.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]