SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002603 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002603
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.14e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000456
Further Details:      
 
Domain Number 2 Region: 183-306
Classification Level Classification E-value
Superfamily E set domains 2.8e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002603   Gene: ENSECAG00000003277   Transcript: ENSECAT00000003723
Sequence length 595
Comment pep:known chromosome:EquCab2:15:40252232:40283986:-1 gene:ENSECAG00000003277 transcript:ENSECAT00000003723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGYNPYIEIMEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKSDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIV
ARIRAGINPFNVPEAQLLDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLWQDCVSFPERPRPGPLGSTGEGRFIKKESNLFSHGAVLTEMPRTSGVSSQTESYYSS
SVSISNALSHHAPAIPSMVPQPSSSWSSVAHPTSHSVNTNPLSSFSTGTLSSNSQGISPF
LEIPLVTDLNASNACIYNNTNDIGRVEASSMSPADLYGISDANMLPNCPVNMITPSNDSM
RETDNPRLVSVTLENPSCNSVLHPRDLRQLHQMSSSSMSAGASSSSTAFVSQSEAFEGSD
FNCADNSMINESGPSNDTNPNSHSFVQSSQYSGIGTLQNEQLSDSFAFDFFPVNL
Download sequence
Identical sequences F6Y9L9
ENSECAP00000002603 9796.ENSECAP00000002603 ENSECAP00000002603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]