SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002684 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002684
Domain Number - Region: 38-137
Classification Level Classification E-value
Superfamily Tropomyosin 0.019
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002684   Gene: ENSECAG00000003973   Transcript: ENSECAT00000003863
Sequence length 275
Comment pep:known chromosome:EquCab2:24:16464908:16465732:1 gene:ENSECAG00000003973 transcript:ENSECAT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNDDDFKTAIIKILNELRENSDRQLNEFRSYVTKEFDTIKKNQTEILEMKNTIEEIKKNL
DALNSRADNMEERISNLEDGNIELLQAEEEREARLKRNEETLRELSDAIRRCNVRIIGIP
EGEEKEKGAENLFKEIMAENFPNLVREMDLQVTEANRSPNFINARRPTPRHIVVKLAKVN
NKEKILRTARQKKLTYKGTPIRLSADFSAETLQARREWNDIFKNLKDKNLQPRILYPAKI
SFKYDGEIKTFPDKQKLREFIATKPPLQEILRKTL
Download sequence
Identical sequences F6XY44
ENSECAP00000002684 9796.ENSECAP00000002684 ENSECAP00000002684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]