SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002687 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000002687
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.0406
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002687   Gene: ENSECAG00000004011   Transcript: ENSECAT00000003868
Sequence length 327
Comment pep:known chromosome:EquCab2:Un0608:6466:7524:1 gene:ENSECAG00000004011 transcript:ENSECAT00000003868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLGGSFGPICEVDVVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY
NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP
VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
KLRKQRTNFHQRFESPESQASAEQPEM
Download sequence
Identical sequences H9GZR5
ENSECAP00000002687 9796.ENSECAP00000002687 XP_005613841.1.31192 ENSECAP00000002687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]