SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002740 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002740
Domain Number 1 Region: 803-911
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-24
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 284-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 5-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 246-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000603
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 661-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000279
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 177-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.032
Further Details:      
 
Domain Number 7 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000015
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000002740
Domain Number - Region: 619-670
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000247
Family Growth factor receptor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002740   Gene: ENSECAG00000000951   Transcript: ENSECAT00000003951
Sequence length 989
Comment pep:known chromosome:EquCab2:28:39581619:39713335:-1 gene:ENSECAG00000000951 transcript:ENSECAT00000003951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEDIDECENDYYNGGCVH
ECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICVNAMGSYECQCHSGFFL
SDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAPNQKDCTLTCNYG
NGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIEKDEAAIERSQFNATSVADVDKRVKRR
LLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRN
TVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYILYGTTH
CGDVDECSMNNGSCDQGCVNTKGSYECVCPPGRRLHWNQKDCVETGKCFSRAKASPQAQL
SCSKVGSVESCFLSCPAHTLFMPDSENSYSLSCGVPSLQGKTLQKRNSTSSGAGPSCSGA
PDTPIRQKARFKIRDAKCHLQARSREPAKEALRQLLLENCHVTFVTLKCDSSKKRRRGRK
SPSKEVTHITAEFEVETKMEEASETCQADCLRKRAEQSLQAAIKTLRKSISRQHFSVQLA
GTEYEVAQRPSKALEGQGACVTGQVLQDGKCVACGPGTYFSGEPSQCVPCTAGTYQDGDA
QLSCTPCPSNDGLGLAGARNVSECGGECSAGFFSTDGFRPCQACPVGTYQPEPGRTGCFP
CGGGLLTKHEGTASFEDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGN
TSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWHISPPPKRRILIV
VPEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNS
GKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKY
TAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences F6WYI8
9796.ENSECAP00000002740 ENSECAP00000002740 ENSECAP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]