SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002841 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002841
Domain Number 1 Region: 17-124,361-670
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.88e-60
Family Integrin alpha N-terminal domain 0.0000345
Further Details:      
 
Domain Number 2 Region: 193-383
Classification Level Classification E-value
Superfamily vWA-like 1.16e-43
Family Integrin A (or I) domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 820-951
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-27
Family Integrin domains 0.0043
Further Details:      
 
Domain Number 4 Region: 670-815
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000889
Family Integrin domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002841   Gene: ENSECAG00000000897   Transcript: ENSECAT00000004112
Sequence length 1171
Comment pep:known chromosome:EquCab2:11:47266961:47311099:-1 gene:ENSECAG00000000897 transcript:ENSECAT00000004112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTHLVVCVACLAPLEAFNVDVAWAWVTPEGGAPYVLSSLLHQDTSTNQTWLLVTSPRTNR
TAEPLHRCSLTQDELFCQPVEHVPIPKGRHRGVTVVGNHHGVLICIQVLARQPHSLSLEL
TGTCSLLAPDLRPQAQVSFSDLENLLDPEAHVDAGDCYRSKKGSTENAARRRRALKPGDE
EEEEEEAAESGSDGSTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECSFALVQ
YGEVIQTEFDLQDSQDVMASLARVQNITQVGNVTKTASAMQHVLDHIFTPSHSSRKKASK
IMVVLTDGDIFGDPLNLTTVINSPKMQGVERFAIGVGEAFQKAKTDKELKLIASDPDETH
AFKVTNYAALDGLLSKLQQNIIPMEGTVGDAFHYQLAQIGFSAQILDEGQLLLGAVGAFN
WSGGALLYDMHGRQGRFLNQTAADANAAPFSYLGYSVAVLHKACGLSYVAGAPRHKQRGA
VFELQKEGSETNFMPVLEGEQMGSYFGSELCPVDINMDGTTDFLLVAAPFYHVHGEEGRV
YVYRLNEQDGSFSLACMLSGYSGFTEARFGFAMATVGDINQDELTDVAIGAPLEGLGSDG
GTSFGSVYIYNGRRDGLSTSPSQRIRASAVAAGLHYFGMSMAGGLDFSGDGLADITVGAL
GRAAVFRSRPVVRLKVSMTFTPEALPIGFNSSVNVCLCFEISSVTTAAESGLRESSLNFT
LDVDVVKQRKRLQCPDRRTCQSYLRKWSSESRLCEPLLLIPTEGELCEEDCFSNISVKVS
YQLQTPEGRRDHPHPVLDLYTEPSAIFQLPYEKACRNKLFCIAELQLAITTSQQELVVGL
TEELTMNISLINSGEDSYMTSMALNYPRNLHFKRIQKPPSPNIQCDDPRPAASVLVMNCR
IGQPVLKRASANFSVVWQLEENAFPNRTANITVTVTNSNEGRSSVRETHSLQFRRAFIAV
LPKPSVMYMNTSRGLSDHKEFLFNIHGENRFGAKFQLQICVPIKLQGIQLVRVKNVTKTQ
AYTVCSQSQQGACGSDPVQSVEEWHSVSCAITSDKENVTVAAELFLSQSEQLLRDVTELQ
ILGELSFDKSLYEGLSAENHRTKVTVIFLKDEEYYSLPVVIGSSVGGLLVLIVIIVVLFK
CGFFKRKYQQLNLDSIRKAQLESENLRTEER
Download sequence
Identical sequences F6WV98
9796.ENSECAP00000002841 ENSECAP00000002841 ENSECAP00000002841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]