SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002858 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002858
Domain Number 1 Region: 564-789
Classification Level Classification E-value
Superfamily vWA-like 2.22e-61
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 4-191
Classification Level Classification E-value
Superfamily vWA-like 1.81e-56
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 276-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 357-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 188-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 479-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000058
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 523-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 865-906
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000000549
Family Chicken cartilage matrix protein 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002858   Gene: ENSECAG00000002579   Transcript: ENSECAT00000004135
Sequence length 909
Comment pep:known chromosome:EquCab2:9:44111902:44197987:1 gene:ENSECAG00000002579 transcript:ENSECAT00000004135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSCENKRADVVFIIDSSRSVNTHDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKN
EFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMI
VTDGRPQDSVAEVAAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQMES
LTSVFQNKLCTVHMCSILEHNCAHFCINTPGSYVCRCKQGYILSSNQKTCRIQDLCAVED
HGCEQLCVNVLGSFVCQCYSGYTLAEDGRRCVAVDYCASENHGCEHECVNADSSYFCRCP
KGFALNPDKKTCTKIDHCASRNHSCQHECVNTDDSYSCRCLKGFMLNPDKRSCRRINYCA
LNKPGCEHECVNTEQGHYCRCRRGYTLDPNGRTCSRVDHCAEQDHGCEQLCLNTGESFVC
QCSEGFLINEDLKTCSRADYCLLSNHGCEYSCVNTDRSFACQCPEGHVLRSDGKTCAKLD
SCALGDHGCEHSCVSSEDSFVCQCFEGYILREDGKTCRREDVCQAVDHGCEHICVNSDDS
YICKCLEGFRLAEDGKRCRRKDVCKSTHHGCEHICVNRGSSYICKCSEGFILAEDGRRCK
RCTEGPIDLVFVIDGSKSLGEENFEIVKQFVTGIIDSLAISPKAARVGLLQYSTQVRTEF
TLRNFGSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVEGARPLSARVPRVAIVFT
DGRAQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEPIDKHLFYAEDFSTMGEIN
EKLKKGICEALEDSDGSQDSPAGELPKRVHQPTESEPVTINIQDLLSCSNFAVQHKYLFE
EDNLSRSTQKLFHSTKSSGSPLEEKPDQCKCENLMMFQNLANEEVRKLTQRLEEMTQRME
ALENRLRYR
Download sequence
Identical sequences F6WP38
9796.ENSECAP00000002858 ENSECAP00000002858 ENSECAP00000002858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]