SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002864 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002864
Domain Number 1 Region: 33-310
Classification Level Classification E-value
Superfamily L domain-like 2.79e-54
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 408-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 460-542
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000373
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002864   Gene: ENSECAG00000004264   Transcript: ENSECAT00000004150
Sequence length 674
Comment pep:known chromosome:EquCab2:13:38580492:38582516:-1 gene:ENSECAG00000004264 transcript:ENSECAT00000004150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRIPPPLLLLLLLLAPGPGVQSCPSGCQCNQPQTVFCTARRGTTVPRDVPPDTTGLYV
FENGITTLDVGSFAGLPGLQLLDLSQNQIASLPSGVFQPLTNLSNLDLTANRLREITNGT
FRGLRRLERLYLGKNRIRHIQPGAFDALDRLLELKLQDNELRALPPLHLPRLLLLDLSHN
SLPALEPGALDTANVEALRLAGLGLRHLDEGLFGRLRNLHDLDVSDNQLEHVPPAIWGLR
GLTRLRLAGNTRIAQLRPEDLAGLAALQELDLSNLSLQALPHELSGLFPRLRLLAAARNP
FNCVCPLSWFGPWVRESRVALISSEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVP
TMRPAAWEPTLSPSSLAPTWLSLTEPATEAPSLPPAAPPTVGPVPQPQDCPTSICLNGGT
CHLEARGHLKCLCPEGFTGLYCESQVQQGPRPSPAPATLRPPRPLPLGIEPASPTSLRVG
LQRYLQGSAVQLRSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRPLG
AGRVPEGEEACGEARTPAAVRSSHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCV
RRGRAAAAAAQGKGQVGPGAGPLELEGVKAPLEPGPKVTEGGGEALPSGPECEVPLMGYP
GPGPQGPLPAKPYI
Download sequence
Identical sequences F6WNQ7
ENSECAP00000002864 ENSECAP00000002864 9796.ENSECAP00000002864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]