SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003124 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003124
Domain Number 1 Region: 584-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-80
Family Eukaryotic proteases 0.0000568
Further Details:      
 
Domain Number 2 Region: 87-217
Classification Level Classification E-value
Superfamily SEA domain 1.05e-21
Family SEA domain 0.0087
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000864
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 4 Region: 361-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000301
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 5 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003124   Gene: ENSECAG00000003906   Transcript: ENSECAT00000004513
Sequence length 829
Comment pep:known chromosome:EquCab2:19:45540909:45577920:-1 gene:ENSECAG00000003906 transcript:ENSECAT00000004513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDISTKPADVNISNISVQVVSAHGKLPGRRPPRKPISKAKPKKQAKKKAPFWNVQ
NKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFVGMFRITNIEFLPEHRQKESREFL
SVAQTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLIHFWIVFVMPHAKGHIFCED
CVATILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGADKGCSQYFYAD
HASFRYPLEISATSGRLMCHFKLVAIVGYLIRFSIESIEIEADNCVTDSLTIYDALLPIR
STILYRICEPTRTLMSFVSTNNLMLVTLKSPQIRSLSGIRAYLEVIPEQKCENTVLVKEI
AGFEGKISSPYYPSYYPPKCTCTWKFQAPLPTLGIALKFHNYSITQKSVKGCDHGWWEIN
EHMYCGSYMDHQTIFRVPRPLVHVQLQCSSRLSDKPLLVEYGSYNISQPCPVASFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVSLQPACNTSSSGPRGPLVCDGFRDCEDGQDEQNCT
QSIPCNNGTFKCSNDICLRKQNAKCDGTVDCPDGSDEEGCSCSGSSSILHRIIGGTDTQE
GGWPWQVSLHFVGVAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADNKGSPVLQQAEVELVDQTLCVSTYGIITSRMLCAGVMSGKRDACRGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences F6SBQ7
ENSECAP00000003124 9796.ENSECAP00000003124 ENSECAP00000003124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]