SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003165 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003165
Domain Number 1 Region: 169-308
Classification Level Classification E-value
Superfamily E set domains 4.34e-51
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000718
Further Details:      
 
Domain Number 2 Region: 60-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003165   Gene: ENSECAG00000004703   Transcript: ENSECAT00000004564
Sequence length 309
Comment pep:known chromosome:EquCab2:26:33927724:33928650:-1 gene:ENSECAG00000004703 transcript:ENSECAT00000004564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGN
VRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSW
TPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCM
FVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSE
GEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILE
GMVEATGKV
Download sequence
Identical sequences F6S482
ENSECAP00000003165 ENSECAP00000003165 9796.ENSECAP00000003165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]