SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003181 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003181
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-39
Family Second domain of FERM 0.000000579
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 3.4e-33
Family Moesin tail domain 0.0000208
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000611
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003181
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00902
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003181   Gene: ENSECAG00000002920   Transcript: ENSECAT00000004590
Sequence length 604
Comment pep:known chromosome:EquCab2:7:18982545:19048837:-1 gene:ENSECAG00000002920 transcript:ENSECAT00000004590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAMWGPKLYALFQMRSCQSS
IKQM
Download sequence
Identical sequences F6S3E5
ENSECAP00000003181 9796.ENSECAP00000003181 ENSECAP00000003181 XP_008526976.1.77740 XP_014596707.1.31192 XP_014699877.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]