SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003208 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003208
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily E set domains 1.91e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000105
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1e-18
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003208   Gene: ENSECAG00000004647   Transcript: ENSECAT00000004624
Sequence length 379
Comment pep:known chromosome:EquCab2:5:37493196:37494389:1 gene:ENSECAG00000004647 transcript:ENSECAT00000004624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAKVYYSQTTQTETRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVAPPSGLRDSTVRYGDPEKLRLEES
LREQAEKEGSALSVRISNV
Download sequence
Identical sequences F6QWP4
ENSECAP00000003208 9796.ENSECAP00000003208 XP_001491261.2.31192 XP_008518707.1.77740 XP_008518708.1.77740 XP_014703817.1.49734 ENSECAP00000003208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]