SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003220 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003220
Domain Number 1 Region: 99-262
Classification Level Classification E-value
Superfamily vWA-like 1.36e-26
Family Integrin A (or I) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003220   Gene: ENSECAG00000001156   Transcript: ENSECAT00000004641
Sequence length 905
Comment pep:known chromosome:EquCab2:16:36891971:36911288:1 gene:ENSECAG00000001156 transcript:ENSECAT00000004641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQDPTLLWQVF
GSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLM
KTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTTG
YKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVGQ
HNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVYE
DALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYVF
AIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTLV
KSLDERYIDEVMRNYTWVPIRSTNYRCPLPFPSHSCPLLPPLLPETMLSMESHKGMSYFE
FLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLI
LDTGITQQLVERVWRDQDLNTLLAVFAATDGGITRIFPNKAAEDWTENPEPFNASFYRRS
LDNHGYVFKPPHQDGECPPSGQLGILVSTAVELSLGGRTLRPAVVGVKLDLEAWAEKGCC
TKLGDPDCGPSSHCEMDCEDLLCILIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMMALY
NNSFYTRKESYDYQAACAPQPQGNLGAAPRGVFVPTVADFLNLAWWTSAAAWSLFQQLLY
GLISHSWFQADPAEAESNPEARESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQKL
INTIIYFMGAEKTLISCPGRSPPTAPPPAPSDGPEQCELVQRPRYRRGPHICFDYNATED
TSDCG
Download sequence
Identical sequences F6QWC7
9796.ENSECAP00000003220 ENSECAP00000003220 ENSECAP00000003220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]