SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003229 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003229
Domain Number 1 Region: 60-393
Classification Level Classification E-value
Superfamily Subtilisin-like 9.16e-94
Family Subtilases 0.000000000859
Further Details:      
 
Domain Number 2 Region: 389-539
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-42
Family Proprotein convertase P-domain 0.00014
Further Details:      
 
Domain Number 3 Region: 595-759
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.47e-34
Family Growth factor receptor domain 0.0003
Further Details:      
 
Domain Number 4 Region: 734-843
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000855
Family Growth factor receptor domain 0.00087
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000272
Family Prohormone convertase 1 pro-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003229   Gene: ENSECAG00000001688   Transcript: ENSECAT00000004651
Sequence length 871
Comment pep:known chromosome:EquCab2:1:106430490:106559862:-1 gene:ENSECAG00000001688 transcript:ENSECAT00000004651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIGNLENYYHFYHSKTFKRSTVSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQAL
YFNDPIWSNMWYMHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPN
YDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRM
LDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLG
SIFVWASGNGGREGDYCSCDGYTNSIYTISVSSTTENGYKPWYLEECASTLATTYSSGAF
YERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHL
KANDWKVNGAGHKVSHLYGFGLVDAEALVMEAKKWTAVPSQHVCVATIDKRPRSIPVVQT
LRTTALTTACADHSDQRVGYLEHVVARISISHPRRGDLQIHLISPSGTKSQLLAKRLLDH
SNEGFTNWEFMTVHCWGEKAEGEWTLEIQDIPSQVRNPEKQGKLKEWSLILYGTAEHPYT
TFSSHQSRSRMLELSALELEPPKAALLPSQAELPEDEEDYTAPSTHGSPNILQTSVCHPE
CGDKGCDGPNADQCLNCVHFSLGNVKTSRKCVSACPLGYFGDTAARRCRRCHKGCETCSG
RSPTQCLSCRRGFYHHQEINSCVTLCPAGFYADESQKNCLKCHPSCKKCIDEPEKCTVCK
EGFSLARGSCIPDCEPGTYFDSELVRCGECHHTCQTCVGPSREECVHCAANFHFQDWRCV
PACGEGFYPEEMPGLPHKVCRRCDENCLSCEGSSRNCSRCKAGFTQLGTSCITNHTCSNA
DETFCEMVKSQRLCERKLFIQFCCRTCLLAG
Download sequence
Identical sequences F6QW48
9796.ENSECAP00000003229 ENSECAP00000003229 ENSECAP00000003229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]