SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003235 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003235
Domain Number 1 Region: 483-687
Classification Level Classification E-value
Superfamily vWA-like 9.6e-54
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 306-495
Classification Level Classification E-value
Superfamily vWA-like 3.76e-46
Family Integrin A (or I) domain 0.00077
Further Details:      
 
Domain Number 3 Region: 41-136
Classification Level Classification E-value
Superfamily LCCL domain 5.89e-30
Family LCCL domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003235   Gene: ENSECAG00000003318   Transcript: ENSECAT00000004661
Sequence length 694
Comment pep:known chromosome:EquCab2:15:60819945:60909930:-1 gene:ENSECAG00000003318 transcript:ENSECAT00000004661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVVLTMKASVIEMFLVLLVTGIHSNKETTKKVKRPKFTVPQINCDVKAGKIINPEFVV
KCPAGCQDPRYHVYGTDIYASYSSVCGAAVHSGVLDNSGGKILVRKVAGQSGYKGSYSNG
VQSLSLPRWRESFIVSEAKPQKGVTYPSALTYSSSKSPAAKAGETTKAYQKPSVPGTTAQ
PVTLIRVLRTTTAEATHTTTLSKPSPSAGSSTSSPRPQPMGQRSQELELWSTTVYTSSPS
SAGTNPGIQRRDSPGAAFQKPAGAYVSLGETDLWKPGSVLLNAGFVPKEELSTQSSEPVS
QGDPSCKIDLSFLIDGSTSIGKRRFRIQKQFLADVAQALHIGPAGPLMGVVQYGDNPATH
FNLKTHVSSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKVNGNRGGAPNVAVVIVDG
WPTDKVEEASRLARESGINIFFITIEGAVENEKQYVIEPNFANKAVCRTNGFYSLNVQSW
FSLHKTVQPLVKRVCDTERLACSKTCFNSADIGFVIDGSSSVGTSNFRTVLQFVANLSKE
FEISDTDTRIGAVQYTYEQRLEFGFDDYNTKPDILNAIKRVGYWSGGTSTGAAINYALEQ
LFKKSKPNKRKLMILITDGRSYDDVRIPAMVAHHKGVITYAIGVAWAAQDELEVIATHPA
KDHSFFVDEFDNLYKSVPKIIQNICTEFNSQPRN
Download sequence
Identical sequences F6QP96
9796.ENSECAP00000003235 ENSECAP00000003235 ENSECAP00000003235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]