SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003305 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003305
Domain Number 1 Region: 24-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-32
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 200-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000208
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003305   Gene: ENSECAG00000004890   Transcript: ENSECAT00000004758
Sequence length 236
Comment pep:known chromosome:EquCab2:24:23434079:23434786:1 gene:ENSECAG00000004890 transcript:ENSECAT00000004758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTVHSVFFTLKLSVLLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLR
TVLVLDGEGQSGELQPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQAMPSFRGLILDLK
YGNSEPRLLGSQGVRLDAEGPCGEGPCENGGICFLLDGHPTCDCSTTGYGGKLCSE
Download sequence
Identical sequences F6PI85
ENSECAP00000003305 9796.ENSECAP00000003305 ENSECAP00000003305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]