SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003361 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003361
Domain Number 1 Region: 508-749
Classification Level Classification E-value
Superfamily vWA-like 2.95e-76
Family Trunk domain of Sec23/24 0.00000547
Further Details:      
 
Domain Number 2 Region: 704-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-39
Family beta-sandwich domain of Sec23/24 0.0007
Further Details:      
 
Domain Number 3 Region: 951-1099
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 9.42e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 4 Region: 282-474
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.8e-29
Family beta-sandwich domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 846-947
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.18e-25
Family Helical domain of Sec23/24 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003361   Gene: ENSECAG00000002321   Transcript: ENSECAT00000004830
Sequence length 1100
Comment pep:known chromosome:EquCab2:14:41153622:41217447:-1 gene:ENSECAG00000002321 transcript:ENSECAT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGVPTSLQAQNGAASASGSPYTNGPVQNALMSSQVSVSQGYNSQLSGSYPH
PIPAKTLNPVSEQPNYGDSQTVSPLSNYQGPGRTINRPPVASNPVTGSLHSGPVPRMPLP
TSQNPAATPMPSGSFLRGANIPPPLNWQYNYPSTGSQTNRCPRASSQPTLSGNTNSTSHQ
YVSSGDPSLQNNFIKSGPMPPLVNPPLPTTFQPGAPLGPPPTGGPPTVRALTPQKSSHRA
MPQPSFNSPINQEGITSNTNNGSMVVHNSYDEIEGGGFLATPQLTNKNPTMSRSVGYSYP
SLPPGYQNTAPPSTAGMPPSSLNYPSGPQAFTQAPFGASHLTASMSGLSLHPEGLRVVNL
LQERNMLPSTPLQPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHP
FKDLVQLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPLTRV
YGEPHRRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNL
DLLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKE
LVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMTVFQTQLPTLGVGALKPRE
EPNQRSSAKEIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSV
YYYPSYHHQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDL
LSLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNE
VFLGADVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVP
FSLRLFPLFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLS
DEGALNINDRTIPQPPLLQLSVEKLSRDGAFLMDAGSVLMLWVGKNCGQNFLSQVLGVQN
YALIPQTMTDLPELDTPESARTIAFISWLRDQRPFFPILYVIRDESPMKANFLQNMVEDR
TESALSYYEFLLHIQQQVNK
Download sequence
Identical sequences F6SQ27
XP_001504440.1.31192 XP_008508388.1.77740 ENSECAP00000003361 ENSECAP00000003361 9796.ENSECAP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]