SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003457 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003457
Domain Number 1 Region: 868-916,947-988
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000168
Family Fibronectin type III 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003457
Domain Number - Region: 456-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family Merozoite surface protein 1 (MSP-1) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003457   Gene: ENSECAG00000001128   Transcript: ENSECAT00000004950
Sequence length 1141
Comment pep:known chromosome:EquCab2:25:20887845:21589955:-1 gene:ENSECAG00000001128 transcript:ENSECAT00000004950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSGTAADISLVHWRQQWLENGTLYFHVSMSSSGQLARATAPTLQEPSEIVEEQMHILHI
SVMGGLIALLLLLLVFTVALYAQRRWQKRRRIPQKSASTEATHEIHYIPSVLLGPQARES
FRSSRLQAHNSVIGVPIRETPILDDYDYEEEEDPPRRANHVSREDEFGSQVTHTLDSLGR
PGEEKGDFGKKGGISFGRTKGMSGSEADDETQLTFYTEQYRSRRRSKGLLKSPVNKTALT
LIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVSEGSYLDISDWLNPAKLS
LYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCHEGYAPDPVHRHLCVRSDWGQSE
GPWPYTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKT
DVLVTEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSG
CVCPEELRPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLPYDATSSTIFMFCGCV
EEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTF
RENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWR
VRSNLYRVKLSTITLSAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCII
HFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCE
EKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSG
KGDVIDDWCRCDLSAFDASGLPNCSPLPQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKV
SDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKC
LEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQ
QTAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCS
SLLRSAYIQSRVDTVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKG
R
Download sequence
Identical sequences F6RBF9
9796.ENSECAP00000003457 ENSECAP00000003457 ENSECAP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]