SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003554 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003554
Domain Number 1 Region: 449-738
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-53
Family Eukaryotic proteases 0.0000164
Further Details:      
 
Domain Number 2 Region: 182-449
Classification Level Classification E-value
Superfamily vWA-like 4.31e-52
Family Integrin A (or I) domain 0.000016
Further Details:      
 
Domain Number 3 Region: 78-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 4 Region: 144-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.00034
Further Details:      
 
Domain Number 5 Region: 17-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000792
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003554   Gene: ENSECAG00000004709   Transcript: ENSECAT00000005079
Sequence length 745
Comment pep:known chromosome:EquCab2:20:31652406:31664670:1 gene:ENSECAG00000004709 transcript:ENSECAT00000005079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCHVPVPTGLAAATPSCPQNVNISGGSFTLSNGWAPGSVLTYSCPLGRYAYPAATRLCK
SNGQWQTPRSTRQTKAVCKPVRCPAPVTFENGMYTPRLGSYPVGGNLSFECEDGFTLRGS
PVRQCRPNGMWDGETAVCDNGAGYCPNPGISVGVVRTGSRFDLGDKVRYRCSSNLVLTGS
SERECQDDGVWSGTEPICRQPYSYDFPEDVAPALGTSLSHLLGATNPTQKKKENVGRKIQ
IQRSGHLNLYLLLDASQSVSEKDFGIFKNSAILMVDRIFSFEINVSVAIITFASRPRIVM
SVLHHNSRDVMEVINSLDNIHYKDHENGTGTNTYEALNSVYIMMNNQMQRLGMNTVAWQE
IRHAVILLTDGKSNMGGSPKLAVDNIKELLNIKQKRNDYLDIYAIGVGNLDVDWRELNEL
GSKKDGERHAFILKDAEALSQVFEHMLDVSQLTDTICGVGNMSANASAQERTPWHVTIKP
KSQETCRGALISDQWVLTAAHCFRQAENHTLWRVSVGDPNAQWGKDFQIEKAVISSGFDV
FAKKNQGIPEFYGDDIALVKLAKKVKMSTHARPICLPCTVGANLALRRPPGSTCQNHEHE
LLNQQSIPAHFVALNGSKLNINLKTGTEWTSCINAVSQDKTTFPNLTDVREVVTDQFLCS
GTGKDDNPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCGRDDKKSRKRAPTGRVPPPRD
FHINLFRLQPWLRQHLEGVLNFLPL
Download sequence
Identical sequences F6PPQ0
ENSECAP00000003554 ENSECAP00000003554 9796.ENSECAP00000003554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]