SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003731 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003731
Domain Number 1 Region: 260-437,478-576
Classification Level Classification E-value
Superfamily L domain-like 2.86e-34
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 750-902
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-32
Family Toll/Interleukin receptor TIR domain 0.00011
Further Details:      
 
Domain Number 3 Region: 49-329
Classification Level Classification E-value
Superfamily L domain-like 1.53e-20
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 4 Region: 536-682
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000201
Family Ngr ectodomain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003731   Gene: ENSECAG00000005400   Transcript: ENSECAT00000005312
Sequence length 903
Comment pep:known chromosome:EquCab2:2:23613296:23616004:-1 gene:ENSECAG00000005400 transcript:ENSECAT00000005312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMCLLLPGLFLSLPLTTGWTASNCLVTEGSRLPLVSRFFLTCPTDSRLHLLAACSSVTN
LTQALEAVPQNVEGLCLAGSTSVLHPDAFSLFPGLKLLGLSLHLTQLLPGALRGLGQLQQ
LFFISRQKDYLFLPPEAFSNLSSLQYLAFLGPCLDGNLGVRLPPSLQRLAIKFSCLQNVG
KLADIFPDLVFGPSSGDARTLDMLDLSFNNQLKMASPGALQGLKLGTLLLDHTKMEAAAV
GGLGLQRLDTLSAMYTATAELPAVAVAHFELEELNLGSTPLGHIALEALASCYSLRSLGL
KSSGLTDLPSGFLAAMPRLQRLNLASNQLRSAMLCTNETGAVSGLQVLDLSQNGLRTLPP
AAFSCLPHLRELLLQGNQLVCLEGQVFQGLRRLEMLDLGRNPLEALGEDWLAPLPALTTL
NLLDTHMVLSSAWVFRGPENLHDLRLQLPSGPSRVALPLPVRLTSLELHAISGREHWKLA
SNIFPVLQTLTLKGWGLQLKTQNVTEIFPALRQLSLLGNSLEALCSQDNSSYFLWQLPGL
QYLRVQGDGHSSRPCCITGLPSLRELKLQAVQSRARPRLVRLEELVGELPSLEVLYLAQT
GLETLSAAAFQGLGSLQVLVLDWETGLVLDSSLQEHSPQMPQYMYILSASLACQCANAWV
GPWHERSPRTYMHVVSQLCHSEAGGRLKNPLFPFLQSHCPTTVGLELFLGSSALLLLLIS
LPLLQEARNSWILYLQALLRAWLQGLKCRRSEGKRFLYDVFVSHCGQDEGWVVWELLPAL
EGCRPAGQGLRLCLPERDFEPGKDVTDNVADSMASSRVVLCVLSRQALRTPRCCLELRLA
TSLLLAAPRPPGLLLVFLEPVSRHQLPRYHRLARLLRRGDYCMWPKEDERKAEFWAWLRS
RLR
Download sequence
Identical sequences F6QJN9
ENSECAP00000003731 9796.ENSECAP00000003731 ENSECAP00000003731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]