SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003831 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003831
Domain Number - Region: 38-137
Classification Level Classification E-value
Superfamily Tropomyosin 0.0118
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003831   Gene: ENSECAG00000005546   Transcript: ENSECAT00000005443
Sequence length 275
Comment pep:known chromosome:EquCab2:7:58463648:58464472:1 gene:ENSECAG00000005546 transcript:ENSECAT00000005443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNDDDFKTAIIKILNELRENSDRQLNEFRSYVTKEFDTIKKNQTEILEMKNTIEEIKKNL
DALNSRADNMEERISNLEDGNIELLQAEEEREARLKRNEETLRELSDAIRRCNVRIIGIP
EGEEKEKGAENLFKEIMAENFPNLVREMDLQVTEANRSPNFINARRPTPRHIVVKLAKVN
DKEKILRTARLKKLTYKGTPIRLSADLSAETLQARREWNDIFKNLKDKNLQPRILYPAKI
SFKYDGEIKTFPDKQKLREFIATKPPLQEILRKTL
Download sequence
Identical sequences F6SSP1
ENSECAP00000003831 9796.ENSECAP00000003831 ENSECAP00000003831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]