SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003867 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003867
Domain Number - Region: 256-363
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.02
Family APC10-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003867   Gene: ENSECAG00000005576   Transcript: ENSECAT00000005491
Sequence length 380
Comment pep:known chromosome:EquCab2:30:29622406:29623611:1 gene:ENSECAG00000005576 transcript:ENSECAT00000005491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGISSVPRPDQNSLSYTLLSLFRATSKIEQKRLTVLVHLADSDLTWLRETTVHISSLFS
PQILAGQLLLIHAPSDIYPTVDDVRDKATQAEFYSKQNIDHAFLMSFATKLSDYFLLLED
NAFCAPNFVTHIHWKVNAMRSDPWVMLEFSNMGFLGKLFHSRDLPVLSHFLLLFYKEKPL
NRLIPHFRTLLAQKNPILCRPFLFYHRISYFTYNDSQKATPVRKKNPYGPDNPPGAIFTD
MKVFDVHFPWEAYTLDESFFWTHNVSAGNHLTVILNHPVNLNRVQVLTGTIVDGKYALEK
GQVELGYDPEGMPQYCTSFAVLGHLLEGQMDQEVFLRSLRYNVSCVRVVVKANQLGGLII
RHIHLWEENAKEAEATESWR
Download sequence
Identical sequences F6SKF2
ENSECAP00000003867 9796.ENSECAP00000003867 ENSECAP00000003867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]