SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003944 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003944
Domain Number 1 Region: 28-354
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-101
Family Glycosyl hydrolases family 35 catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 473-622
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.78e-31
Family Beta-galactosidase LacA, domains 4 and 5 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003944   Gene: ENSECAG00000003253   Transcript: ENSECAT00000005591
Sequence length 651
Comment pep:known chromosome:EquCab2:6:8775306:8785840:-1 gene:ENSECAG00000003253 transcript:ENSECAT00000005591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKPPCLPSLLLPLLTLLLPQADTRSFVVDRDNDRFLLDGVPFRYVSGSLHYFRVPRV
LWADRLFKMRMSGLNAVQFYVPWNYHEPEPGVYNFHGSRDLIAFLNEAAIANLLVILRPG
PYICAEWDMGGLPAWLLRKPKIHLRTSDPDFLAAVDSWFKVLLPKIHPWLYHNGGNIISI
QVENEYGSYRACDFNYMRHLAGLFRAILGDEILLFTTDGPEGLKCGSLEGLYTTVDFGPA
DNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVHSVTNGLENMLKLGASVNM
YMFHGGTNFGYWNGADEKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQEIPLG
PLPPPSPKMMLGPLTLHLDGDLLAFLNYLCPQGPIYSILPMTFEAVKQDHGFVLYRTYLS
NTVSEPTRFWVPNNGVHDRAYVMVDGVFHGVLERNMKHKLFLTGQVGAKLDVLLESMGRL
SFGSNTSDFKGLIEPPVLGQTILTRWLMFPLKVDKLVKWWFPLQLLKRSHPQTPSGPTFY
STMFAILGSSGDTFLYLPGWTKGQVWINGFNLGRYWTKRGPQQTLYVPRPLLYPRGALNK
ITLLELENAPPQPQVQFLDRPILNSTLHRTYVYSLSAEVQSDPEPMQLSGH
Download sequence
Identical sequences F7CUS0
9796.ENSECAP00000003944 ENSECAP00000003944 ENSECAP00000003944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]