SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004020 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004020
Domain Number 1 Region: 546-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 125-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 65-114
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004020
Domain Number - Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004020   Gene: ENSECAG00000004217   Transcript: ENSECAT00000005696
Sequence length 584
Comment pep:known chromosome:EquCab2:2:2877629:2913582:1 gene:ENSECAG00000004217 transcript:ENSECAT00000005696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKMRTSESGAWGALAQLLLLWAALAWLGLPGSRGEKPRSLQSNAVNESLAKHRQTRSVDV
TPTPIDCELSSWSSWTTCDPCQKKRYRHVSLLRPSQFHGEPCNFYDKEVEDCVTNRPCRS
QVRCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWAIGRLATG
INLFTNRLEGPVLDHRYYGGACSPHYILNTRFRKPYNVESYSPQTQGKYEFALTEYESYS
DFEHNVTETATSMSRFSFGFKKPGIFELGISSASGNAKHFISRTKRFSHTKSTFLHARSD
LEVAHYKLKPRSLMLHYEFLQRVKQLPLEYGYGEYRDLFRDFGTHYITEAVLGGIYEYTL
IMNKEAMERADYSLKDVLACAKNDFKIGAAITMVYVKLGVSVDKCQRILKEIEERNKRNT
MVDDLVVLVRGGASEYITALAYKQLPTADLMQEWGDAVQYNPDIIKIKAEPLYELVTAAD
FAYSSTVRQNMKQALEEFQKEVSSCHCAPCRGNGVPVLKESRCECICPVGFRGPGCEVTD
RKNVPIDGKWNCWSNWSPCSGGRKTRQRQCNNPPPQNGGRPCWG
Download sequence
Identical sequences F7AXF6
ENSECAP00000004020 9796.ENSECAP00000004020 ENSECAP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]