SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004108 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004108
Domain Number 1 Region: 151-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.4e-81
Family Eukaryotic proteases 0.000000096
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 3.73e-25
Family GLA-domain 0.00012
Further Details:      
 
Domain Number 3 Region: 92-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004108   Gene: ENSECAG00000004998   Transcript: ENSECAT00000005832
Sequence length 446
Comment pep:known chromosome:EquCab2:17:79888991:79901360:1 gene:ENSECAG00000004998 transcript:ENSECAT00000005832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQPRGLGLLCLLLGLQGSLAAVFITQEEAHSILHRQRRANWFLEELKPGSLERECKEE
QCSFEEAREIFKDTERTKQFWLSYTDGDQCASNPCQNGGSCEDQLQSYICFCLDGFEGRN
CETNTDDQLICMNNNGDCEQYCSDHAGARRSCWCHEGYTLQANGVSCTPTVEYPCGKIPV
LEKRNDTKPQGRIVGGKVCPKGQCPWQALLKMNGELLCGGTLLDTTWVVSAAHCFDRIRS
WKNLTVVLGEHDLSEEDGDEQEQQVAQIIVPDKYVRLKTDHDLALLRLRRPVTFTDYVVP
LCLPEKAFSERTLTLVRFSSVSGWGQLLHRGATALELMLINVPRLRTQDCLEQSHRMEGS
PALTENMFCAGYVDGTQDACKGDSGGPHATKFQGTWYLTGVVSWGEGCAAVGHFGVYTRV
SQYIEWLRRLMRSEPHSEGLFRAPFP
Download sequence
Identical sequences F7ABW7
ENSECAP00000004108 9796.ENSECAP00000004108 ENSECAP00000004108 XP_001497249.2.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]