SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004160 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004160
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-60
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 773-884
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 467-572
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-37
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 4 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 908-1001
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-27
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000439
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004160   Gene: ENSECAG00000002251   Transcript: ENSECAT00000005915
Sequence length 1012
Comment pep:known chromosome:EquCab2:2:68722155:68911692:-1 gene:ENSECAG00000002251 transcript:ENSECAT00000005915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLETLSPRMLMWLVASGIAFYGELWVCAGFDYDYTFDGNEEDRAETIDYKDPCKAAVFW
GDIALDEEDLNIFQIDRTIDLTQNPFGKLGHTTGGLGDHGMSKKRGALYQLIDRIRRIGS
GLEQNNTVKGKVPLKFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVFKTICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKITVSEDYYVGLTFQAFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD
KPEDIKSTSNTLWMKFVSDGTVNKAGFAANFFREEDECAKPDRGGCEQRCLNTLGSYQCG
CEPGYELGPDKRTCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYVCQCRNGFVLHENKHDCKEAECEQKIHS
PSGFITSPNWPDKYPSRKECTWEISATPGHRVKLAFSEFEIEQHQECAYDHLEVFDGETE
KPILGRLCGNKIPEPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLY
SHAQFGDNNYPGQIDCEWLLVSERGSRLELSFQIFEVEEEADCGYDYVELFDGLDSTAVG
LGRFCGSGPPEEIYSIGDTVLIQFHTDDTINKKGFHIRYKSIRYPDTTHTKK
Download sequence
Identical sequences F7A5S8
ENSECAP00000004160 9796.ENSECAP00000004160 ENSECAP00000004160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]