SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004214 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004214
Domain Number 1 Region: 3173-3437
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-51
Family YWTD domain 0.00000248
Further Details:      
 
Domain Number 2 Region: 1411-1672
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-47
Family YWTD domain 0.0000079
Further Details:      
 
Domain Number 3 Region: 369-630
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-44
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 4 Region: 704-941
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-43
Family YWTD domain 0.0000196
Further Details:      
 
Domain Number 5 Region: 2363-2600
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-40
Family YWTD domain 0.0000222
Further Details:      
 
Domain Number 6 Region: 2038-2309
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-38
Family YWTD domain 0.0000321
Further Details:      
 
Domain Number 7 Region: 1720-1984
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-37
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 8 Region: 4031-4300
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-36
Family YWTD domain 0.0000351
Further Details:      
 
Domain Number 9 Region: 238-254,289-358,623-679
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 2831-2871
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 11 Region: 1238-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 12 Region: 3084-3165,3430-3493
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000534
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 2709-2750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 15 Region: 3692-3729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 1079-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 1121-1158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 18 Region: 3601-3640
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 19 Region: 1038-1077
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 20 Region: 2960-3001
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 21 Region: 3484-3519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 22 Region: 3001-3043
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 40-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 24 Region: 3771-3808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 155-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 26 Region: 3814-3850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 27 Region: 995-1033
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3520-3562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 3043-3083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 3899-3936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 189-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3559-3603
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 33 Region: 2672-2710
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 34 Region: 2877-2913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 35 Region: 1327-1371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 36 Region: 80-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 37 Region: 2787-2833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 38 Region: 3730-3768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 1202-1237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 40 Region: 1159-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 41 Region: 1995-2033,2319-2356,2617-2681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 42 Region: 119-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 2917-2961
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 44 Region: 3856-3894
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 45 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 46 Region: 3655-3688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 47 Region: 1356-1403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 48 Region: 3981-4016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 49 Region: 2754-2792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 50 Region: 3943-3981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000311
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004214
Domain Number - Region: 4355-4386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1681-1725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 952-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4298-4385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004214   Gene: ENSECAG00000000435   Transcript: ENSECAT00000005992
Sequence length 4635
Comment pep:known chromosome:EquCab2:18:48782680:48943011:-1 gene:ENSECAG00000000435 transcript:ENSECAT00000005992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECDSEHFRCENGHCIPASWRCDGTKDCLDDSDETGCPPSSCQSGQFKCQSEGLCIPHSWV
CDDEHDCEDGSDEQHCRGTTCSSDQITCSSGECIPNEFRCDHTRDCSDGTDERDCHYPTC
TQLTCANGACYNISQVCDGKADCRDSSDENNCTKICSQNEFQCGSGECIPHAYLCDHDHD
CEDGSDENSCTYQTCRGNEFTCPSGYCISQDWVCDGEDDCTDNGDEDGCESSTHHIHKCY
PGEWACPGSGKCIPIGKVCDGTLDCPAGEDESNITQGQNCDVNLCPLLGCEYQCHMSPHG
GMCYCPSGFIVDQNSTRNCVDFDDCEIWGICDQMCEDRVGHHQCHCAEGYILEHQRHCKA
NTSSGEASVIFSNGRDLLIGDIHGRTFEMLVQSQNHGVAVGVDFHYHLHRVFWTDTVQDK
VFSVDVNGLHIQEVLNVSVDDPENLAVDWVNNKLYLVETRVNCIEMVNLDGSQRVILITE
NLGHPRGIALDPTVGYLFFSDWESLSGGPKVERAFMDGTNRKDLVKTKLGWPAGITLDMV
SKRVYWVDCRFDYIETVTYDGIQRKTVVHGGSLVPHPFGISLFEDNVFFTDWTKMAVMKA
NKFTETNPETYYRTSLRPFGVTVYHPLRQPYVRNPCGDNNGGCEQICVLSHRTDNDGLGY
RCKCSLGFDMDADERHCVAVKQFLIFSSEVAVRGIPFTLSTQEDVMVPMTGNPSSFVGID
FDAQESTIFFSDTSKDMIFKQKIDGTGREVVTASMVEGVESLSFDWISKNLYWTEASYKS
VSVMRLADKSRREIIKNVNNPRSIVVHPIAGYIFFSDWYRPAKILRAWSDGSNVVPIVNT
TLGWPNGLAIDWGALRLYWVDAFFDKIEHSTFDGSERRALGHIPQMAHPFGLTVFQDYLF
FTDWRLGAIVRVRKTDGGDRTVIRSGISKIMQVKSYDANTQTGSNYCNRPTHPNGDCSHF
CFPVPNLQRVCGCPYGMTLTSNHLTCVEDPSHEPPIEHCGSFSFTCNNGRCVPTYYRCDG
VDDCHDNSDEHLCGTSNNTCSPSAFTCGHGGECIPGHWRCDRHADCVDGSDEQNCPTQTP
TSCPASSFTCDNHHCISRNWVCDTDNDCGDGSDEKDCELPETCLPTQFRCPGHRCIDLSF
VCDGDSDCVDGSDEQACFINCTASQFKCASENRCISNVYHCDGVFDCTDHSDETDCSTRP
SGMCHPDEFQCQADGTCIPGSWECDGHRDCISGSDEHQGCSPRTCPPSHFLCDNGNCVYK
EWLCDGDNDCRDMSDEKDCPTQAFHCPVGQWQCPGHSVCVNLSAVCNGISDCPNGTDESP
LCNQESCSDSNAGCTHQCIQGPFGAQCLCPLGFLLANDSKTCEDIDECEIPGYCSQHCYN
MRGSFRCWCDKEYMLDTDGRTCKVTASESLLLLVASRNQIVADNITSQVHNIYSLIQDGS
HIVAIDFDSVSGRVFWSDGTQGKIWSAFQNGTDKKVVLDSGVTMTESIVVDWVGRHLYWT
NYALETIEVCKLDGSHRTVLISENVTNPRGLALDPRISEHLMFWSDWGHHPRIERASMDG
SLRTVIVQDKIFWPNGLTIDYPNRLLYFMDAYLDYIDFCDYDGQHRRQVIASDLILRHPY
ALTVFEDSVYWTDRATHQVIQANKWHGWNQSVIMYNVYQPLGIVAVHPVKQPHSENSCTF
APCSHLCLLSSEGPHFYSCVCPSGWSLSQDSATCVRDDEPFLIVVRHSIIFGISLNPEVK
SNDAMIPIAGIMNGYDVEFDDSEQFIYWVENPGEIHRVKTDGTNRTIFVPLSRLGSSMSL
ALDWISRNLYYTNPGTQSIEVLTLRGNVRYRKTLITNDGTAFGVGFPIGITVDPANGKLY
WSDQGTDSGVPAKIASANMDGTSSKTLFTGNLEHVEFITLDLQEQKIYWAVTSRGVIERG
NVDGTDRTILVNYLSHPWGIAVHGSFLYYTDEHYEVIERVDKNTGANKVVLRDNIPHLRG
LRVYYKRDAAESSNGCSNNVNACQQICLPVPGGLFSCACATGFKLNPDQQTCSPYESFIV
VSMLSAIRGFNLDLSDHSEAMVPVAGQGRNALHVDVDVSSGFIYWCDFSSSVADYNAIRR
IKPDGSAFMNIVTHGIGENGVRGIALDWVAGNLYFTNAFLSETLIEVLRINTTYRRVLLK
VIVDMPRDIVVDPKNRYLFWADYGQNPKIERSFLDCTNRTVLVSEGIVTPRGLAVDHNNG
YIYWVDDSLDMIARINIEGEESEVIRYGSRYPTPYAITVFEDSIIWVDRNLKKIFKASKE
PDNTELPTVIRDNINWLRDVTIFDKRVQPRSPEAVNNNPCLENNGGCSHLCFALPELHTP
KCGCAFGTLESDGKSCAIPTEHFLVFAMDDSLRSLYLDPENHNPPFQAISVEGIAVDLDY
DSIHNRIYFTHSLSPRHSQISYVNLNSGIVSPTVIVSDIGAADGIAFDWINRRIYYSDYT
NQTINSVAEDGSKRTVIAHVSKPGAIVLDPCRGYMYWTDWDTNAKIERATLGGNFRVPIV
NSSLVWPNGLALDTEEDLLYWADASLLKIERSTLTGLEREVIVSATFHPFGLTLYGQYIY
WTDFSAKKVYRANKYDGSGQMAMTTRFSFEPEGIRVVVKDQQRQCSNPCDEFNGGCSHIC
APGPNGAECQCPHEGRWYLANDNKHCIVDNGTRCDSSKFTCLNGHCISEQWKCDNDNDCG
DGSDELESVCAFHTCPLTAFTCDNGRCVRYHYRCDHYNDCGDNSDEAGCLFRDCNATTEF
TCSNRRCIPLQFVCNGINNCHDNDTSDEKNCPDRTCRPGYIKCQTTNICIPRLYLCDGDN
DCGDMSDESPIFCASQTCSSTEFQCTSGRCIPIHWYCDQERDCSDGSDEPSTCVHDEPTC
LSDEFKCDSGRCIQREWICDGDNDCGDMSDEDERHQCENRSCSGSQFHCVHSTPPSRRCI
PQSWVCDGDADCADGYDEHQNCTRRSCSENEFTCSNGLCVPHSYRCDWRNDCGDYSDERE
CSYPTCNENQFTCQNGICIYKVYTCDGENDCGDDSDELEHLCHTPETTCHPHQFKCDNGN
CIEMVKVCNHLDDCLDNSDEKGCGINECNDASLSGCDQNCTDTLTSFYCSCHPGYKLMSD
KRTCNDIDECKETPFVCSQKCENVIGSYICKCAPGYIREPNGKNCRQNSDIEPYLIFSNR
YYLRNLTTDGHYYSLILQGLGNAVALDFDRVEKRLYWIDRENKVIERMFLNKTNRETVIN
HRLPAAESLAVDWVTRKLYWLDTYLKCLSVSELNGQYRRKLAEHCVDANNTLCFENPRGI
VLHPQYGYVYWADWASRAYIGRVGMDGTNKSVIISTKIVWPNGITIDYTNDLLYWADAHL
GYIEYSDLEGNHRHTVYDGMLPHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSDRMVLVN
TTHKPFDIHVYHPYRQPIVNNPCGTNNGGCSHLCLIKAGGKGFTCECPDSFQALRLDDRT
HCLPLCSSTQFLCANNEKCIPIWWKCDGQRDCSDGSDEPTICPPRYCRLGQFQCKDGNCT
SPHFLCNAHEDCPDGSDEDHILCEHHQCESNEWQCANKRCIPEAWQCDSENDCEDNSDED
SSHCARRICQPGYFMCANGRCIPQNWKCDVDNDCGDYSDEPIQECMSAAHRCDNYTEFSC
RTNYRCIPQWAVCNGFNDCRDNSDEQGCEEMTCNPVGDFRCKNHRCIPLRWKCDGHNDCG
DHSDEEDCVPRECTESEFRCGDQSCIPSRQICDHFDDCGDNSDERDCDMRTCHPGYFQCN
SGHCMPDQLKCDGFADCFDSSDEAACPTRFPNGAYCPATEFECKNHVCVQLSWKCDGDDD
CGDGSDEELHLCLNVTCVSPNRFRCDNNRCIYSHELCNQIDDCGDGSDEKKENCADPTPR
PCKEDEFKCSNGHCISQHLVCDDFDDCGDHFDETGCNTGKERSCAENLCEHNCTQLKEGG
FICTCRPGFKASTLDRNSCDDINECEQFGVCPQNCHNTKGSYECSCAQGFKSMGDDYGKR
CAADGNPPLFLLAENVRIRKYNLSSEKYADYLEDEEHIQAIDYDWDPDGIDLSVVYYTVL
GHGSNFGAIKRAYIPNFESENNNIVQEVNLDLKYIAQPDGLAVDWVGRHIYWSDAKSQRI
EVAKLDGRYRKWLISTQLDQPAAVVVNPKLGLMYWTDWGKEPKIESAWMDGQHRIILVKE
DLGWPTGLSIDYLNNDQIYWSDFKENVIETMKHDGTDRRTVVNAAVNPYSLDIFEGELYW
ISKDKGEVWKQDKFGRDEKEKMLVVNPWLTQVRIFQQYRYNQSVPNRCKKVCSHLCLLRP
GGYSCACPQGSTFIAGSITECNAAIESPIMMPPPCRCMHGGNCYFDENDLPKCKCLSGYM
GKYCEAGLSKGVPPGTTVAVLLTVILIIIIGALAMLAFFHYRRTGSLLPALPKLPSLSSL
VKSSENGNGVTFRSGADVNMDIGVSGFGPESAIDRSMVMSEHFAMEMGKQPIIFENPMYT
AKEKDSAVKLNKQAPSICAQVTVSGNVDNRNYGSPINPSEIVPDTQPASPTADGTQATKW
NIFKRKPKQTTNFENPIYAEMDDDQKESGPTAVVPLPSPSPAAEIPSKRSSAPTYTATED
TFKDTANLVREDSEV
Download sequence
Identical sequences F6ZGI6
ENSECAP00000004214 9796.ENSECAP00000004214 ENSECAP00000004214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]