SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004351 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004351
Domain Number 1 Region: 855-1102
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-76
Family Eukaryotic proteases 0.0000993
Further Details:      
 
Domain Number 2 Region: 521-642
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-36
Family Frizzled cysteine-rich domain 0.00013
Further Details:      
 
Domain Number 3 Region: 206-318
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.23e-31
Family Frizzled cysteine-rich domain 0.00071
Further Details:      
 
Domain Number 4 Region: 648-685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 415-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 338-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 722-764
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 448-483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 689-720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 768-858
Classification Level Classification E-value
Superfamily SRCR-like 0.0000759
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004351   Gene: ENSECAG00000005039   Transcript: ENSECAT00000006170
Sequence length 1108
Comment pep:known chromosome:EquCab2:3:81022733:81231833:1 gene:ENSECAG00000005039 transcript:ENSECAT00000006170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRISFGVRVGSVRRPRSPCRGRCHVSCRVPPPLGALYASSGLGGARAPGEAAEGAVGTS
PSGTHGFLSAPASPTPGIWKDCAAALPAPDVLRADDGSMGDGCSQKLATANILRFLLLVL
IPCICALIVLLVVLLCFVGTLKKAYFKSNGSEPLVTDGEVQVSDVILTNTVYNESPVTST
AHPSQHIPAWTTDASFPEDHNHRNTSACTRITHSQCQMLPYRTTLTPLLSIIKNMEMEKF
LKFFTYLQRLSCYQHIMLFGCSLAFPECIGDGDDSHGLLPCRSFCEAAKEGCESVLGMVN
ASWPDFLKCSQFRNQTESSNVSRICFSPQQEEGKQLLCGESESFLCASGICVPRKLQCNG
YNDCDDWSDEAHCNCSKDLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTEEHRCG
DGRCIAIEWVCDGDHDCVDKSDEANCSCHSQGLVECRNGQCIPSTFQCDGDKDCKDGSDE
ESCGDSQTPCQEGDQRCRYNSCLDSCGGSSLCDPNSPNNCSQCEPITLELCMNLPYNHTN
YPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTNHRIPPCRAL
CEHAKEHCESVLGVVGLQWPEDTDCNQFPEENSDNQTCLMPDEDVEECSPSHFKCSSGRC
VLASRRCDGQADCDDDSDEENCGCEERELWECPSNKQCLKPIVICDGFPDCPESMDEKNC
SLCQDDDLECANHECVSRDRWCDGEADCLDSSDEWDCVTLSKKVNSSSFLTVHKSAREHH
VCADGWQETLSQLACKQMGLGEPSVTGMIQEQEQDQQWLTLHSNWESLSGTTLHELLVEG
QSCHSRSKISLLCTKQDCGHRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVL
IAKKWVLTVAHCFEGRENAAVWKVVCGINNLDHPSTFMQTRHVKTIILHPRYSRAVVDYD
ISIVELSEDINETSYVRPVCLPNTGQLLEPDTYCYITGWGHMGNKMPFKLQEGEVRIIPL
EQCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCERPGGEWTLFGLTSWGSVCFS
KVLGPGVYSNVSYFVEWIERQVYIHTFL
Download sequence
Identical sequences F7B252
9796.ENSECAP00000004351 ENSECAP00000004351 ENSECAP00000004351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]