SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004391 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004391
Domain Number 1 Region: 763-1017
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.42e-88
Family Eukaryotic proteases 0.0000000378
Further Details:      
 
Domain Number 2 Region: 344-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-37
Family MAM domain 0.0055
Further Details:      
 
Domain Number 3 Region: 523-633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 225-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-19
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 5 Region: 59-166
Classification Level Classification E-value
Superfamily SEA domain 2.88e-17
Family SEA domain 0.0081
Further Details:      
 
Domain Number 6 Region: 673-774
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000706
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 
Domain Number 7 Region: 640-678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 182-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004391   Gene: ENSECAG00000005221   Transcript: ENSECAT00000006223
Sequence length 1019
Comment pep:known chromosome:EquCab2:26:16729715:16967922:-1 gene:ENSECAG00000005221 transcript:ENSECAT00000006223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKRSVPSRHCSLSTYEVMFAVLFSILVIVCAGLIAISWLAINDSERDAEFGNSHEARG
TLKITSGATYNPNLQDKLSVDFKVLAFDLQQMIDEIFQSSNLKNEYKNSRVLQFENGSIT
VIFDLFFAQWVSDENVKEEMIQGIEANKSSQLVTFHIDLNSIDITDKLTTNSPTANPGNI
SVECLPGSRLCADALKCVAIDLFCDGELNCPDGSDEDNKICATACDGRFLLTGSSGSFQA
AHYPNPSTPSVVCQWIIRVNQGLSIELSFDSFNTYYTDVLNIYEGVGSSKILRASLWETS
PGIIRIFSNQVTATFLIESDENDYIGFNATYTAFNSTELNNYEKINCDFEDGFCFWVQDL
NDDNEWERVQGSTFPPFTGPDFDHTYGNVSGFYISTPTGPGGRRERVGLLSLPLDPTLEP
VCLSFWYYMYGENVYKLSINISSDQNMEKMIFQKEGNYGETWNYGQVTLNETVEFKVAFN
AFKNQLLSDIALDDISLTNGICNVSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFTSM
NFPNNYPNQAFCVWNLNAQEGKNIQLHFQEFDLENIADVVEIRDGEGDDSLLLAVYTGPG
PVKDVFSTTNRMTVLLITDNLLTKAGFKANFTTGYHLGIPEPCKEDNFQCKNGECVPLVN
LCDGLPHCPDGSDEAHCVRLFNGTTSNNGLVQFRIQSIWHVACAENWTTQISNDVCQLLG
LGSENSSVPIYSTEGGPFVKLNTASNGSLTLTPSEQCLQDSLVLLQCNHKACGKRLVAQE
VSPKIVGGNNAKEGAWPWVVALSYNDRLLCGASLVGSDWLVSAAHCVYGRNLEPSKWKAI
LGLQMTSNLTSPQVVTRLIDQIVINPHYNKRRKESDIAMMHLEFKVNYTDYIQPICLPEE
NQVFPPGSICSIAGWGTVEYQGSTADILQEADVPLLSNEKCQQQMPEYNITENMVCAGYE
KGGVDSCQGDSGGPLMCQENNRWFLAGVTSFGYQCARPNRPGVYARVSRFTEWIQSFLY
Download sequence
Identical sequences F7AVP5
ENSECAP00000004391 9796.ENSECAP00000004391 XP_003364265.1.31192 ENSECAP00000004391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]