SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004411 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004411
Domain Number 1 Region: 231-472
Classification Level Classification E-value
Superfamily vWA-like 1.57e-35
Family Integrin A (or I) domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004411
Domain Number - Region: 545-570
Classification Level Classification E-value
Superfamily YueI-like 0.0955
Family YueI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004411   Gene: ENSECAG00000003355   Transcript: ENSECAT00000006249
Sequence length 891
Comment pep:known chromosome:EquCab2:16:34960609:34974597:-1 gene:ENSECAG00000003355 transcript:ENSECAT00000006249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAQWPCLILALLSYLAASGFPRSPSRPLGRQSLPEGVVDGIEVYSTKISCKVTSRFAH
NVVTTRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVS
QGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
HFEIEADIFEPQGISTLDAEASFVTNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCT
DSLLNGDFTITYDVNRESPANVQIVNGYFVHFFAPQGLPVVPKNVVFVIDVSGSMYGRKI
QQTKDALLKILEDVKEDDYLNFILFSGDVTTWKDNLVQATPENIQQAREFVMNIHSQGMT
NINDALLRGISMLNKAREENAVPERSTSIIIMLTDGDANVGESKPEKIQENVHNAIRGKF
PLYNLGFGNNLNYNFLESMALENHGLARRIYEDSDANLQLQGFYEEVANPLLTSVEVEYP
ENAILDLTQNTYQHFYDGSEIVVAGRLVDKDLNNFKADVKGHGAINDLTFTEEVDMKEME
EALRERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTAQALDLSLKYHFVTPLTS
MVVTKPEDNEDQTAIADKPGEGPTDAEVTPSMAYLTSYQRPQTPYYYVDGDPHFIIQVPE
KDDAICFNIDEDPGTVLRLIQDPITGLTVNGQIIGDKRDSPDSKTSKTYFGKLGIANAQM
DFQIEVTPEKIILRNGAAQSTFSWLDTVTVRQDGLSVTINRKKNMVISFGDGVTFVVVLH
QVWKKHPVHQDFLGFYVVDSHRMSTQTHGLLGQFFHPFEFKVSDVHPGSDPTKPDATMVV
KNHRLTVTRGSQKDYGKDVSSGTKVTCWFVHNNGQGLIDGVHSDYIVPSLF
Download sequence
Identical sequences F7AE68
ENSECAP00000004411 ENSECAP00000004411 9796.ENSECAP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]