SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004647 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004647
Domain Number 1 Region: 16-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000004647
Domain Number - Region: 379-639
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0568
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004647   Gene: ENSECAG00000005896   Transcript: ENSECAT00000006533
Sequence length 644
Comment pep:known chromosome:EquCab2:5:83968157:84071915:1 gene:ENSECAG00000005896 transcript:ENSECAT00000006533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSGNGVSICEDDNECGNLTQSCGEHANCTNTEGSYYCMCVPGFKSSSNQERFITNDGT
ICIEVNAECHLDNVCIAANINKTLTKIRPIKEPVALLQEVYRNSVKDLSPTDIITYIEVL
AESSPLLGYVNSTNSAMDALSNSTLTEFVKTVNNFVQKDTFIVWNKLSVNRRRTHLTKLM
HAAEQATLRISQNFQKTTQFDANSSDVALKAFFFDSYHMKHIHPHMNVDGDYIKIFPKRK
SAYDSDGNAAVAFLYYKSVGPLFSSSDNLLLESQSHDNSEEEERVISSVISVSISSNPPT
LYELEKITFTLSHIKTTDKSRSQCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCHCNHL
THFAILMSSGPSIGIKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNL
CCNLFLAELVFLVGINTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNK
GFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNL
LAFGFIIYKVFRHTAGVKPGVSCYENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTA
YLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences F7B4Y5
9796.ENSECAP00000004647 ENSECAP00000004647 ENSECAP00000004647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]