SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 69_2 > ENSECAP00000004981

Domain assignment for ENSECAP00000004981 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000004981
Domain Number 1	Region: 130-173
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000000437
Family	EGF-type module	0.0074
Further Details:

Domain Number 2	Region: 15-59
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000042
Family	EGF-type module	0.012
Further Details:

Domain Number 3	Region: 58-103
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000778
Family	EGF-type module	0.006
Further Details:

Domain Number 4	Region: 163-199
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000595
Family	EGF-type module	0.014
Further Details:

Domain Number 5	Region: 97-135
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000317
Family	EGF-type module	0.011
Further Details:

Weak hits

Sequence:	ENSECAP00000004981
Domain Number -	Region: 1-19
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00657
Family	EGF-type module	0.048
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000004981 Gene: ENSECAG00000006935 Transcript: ENSECAT00000006912
Sequence length	199
Comment	pep:known chromosome:EquCab2:20:57655247:57680168:-1 gene:ENSECAG00000006935 transcript:ENSECAT00000006912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	CECTSGWTGQNCSEEINECDSDPCLNGALCHESTIPGQFVCLCPPFFTGKFCQEYRSSCD PLNDPCRNNATCLTLVDGQRYCVCREGFEGEHCEINTNECFSLPCQNYGDCEDGVNSFRP GFSGPLCEIETNECSSKPCKNNGTCVDLTNRFLCNGEPGYSGSFCELDMNECETSPCPDG ENCVNRTGGYKCLCAPGYT
Download sequence
Identical sequences	F6UHK3 ENSECAP00000004981 ENSECAP00000004981 9796.ENSECAP00000004981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]