SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005022 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005022
Domain Number 1 Region: 567-827
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-90
Family Eukaryotic proteases 0.0000000183
Further Details:      
 
Domain Number 2 Region: 313-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-28
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 3 Region: 200-282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000837
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 4 Region: 52-147
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000798
Family SEA domain 0.0099
Further Details:      
 
Domain Number 5 Region: 462-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 498-534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 427-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 537-578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000238
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005022   Gene: ENSECAG00000006391   Transcript: ENSECAT00000006956
Sequence length 828
Comment pep:known chromosome:EquCab2:7:38671426:38690129:1 gene:ENSECAG00000006391 transcript:ENSECAT00000006956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNMNGFEEGVEFLPVNNTRKVEKRGPRRWVVLVAVLGCFFLLSLITGFLVWHFQYRNVR
VQIFNGYLRISNEFLDAYENSNSTEFVNLANKVKEALKLLYSRVPALGPYHKESAVTAFS
EGSVIAYYRSEFSIPTHLVEEAERAMAQERTVTLPPRARAMQSFVLTSVVAFPTDPRTAQ
TTQDNSCSFALHARGRELTRFTTPGFPDSPYPAHARCQWTLRGDADSVLSLTFRSFDVAN
CDDRGNDLVMVYDTLSPVEPRALVQVYCDDLSKSVNLPELTSVSVFLFSLSVNGDKTRPG
WGPPLFLLPSPSGCGGSLREAQGIFSSPYYPGHYPPNVSCTWDIQVPNNQNVKVLFKSFY
LVEPNLPPGSCPKDYVEVNGERYCGERPQFVVSSKSSRITVRFHSDQSYTDTGFLAEYLS
YDSSDPCPGKFMCNTGRCIRSELRCDGWADCTDYSDELGCKCDASHQFTCKNKFCKPLFW
VCDSVNDCGDNSDELECSCPAQSFKCANGKCLPQSQKCDGKDDCGDRSDEATCDSVSTVT
CTEHTYRCDNGLCLSKGNPKCDGKKDCSDGSDENNCDCGLRPFTRQSRVVGGTDADEGEW
PWQVSLHALGQGHVCGASLISPSWMVSAAHCYVDDRGFRYSTTMWTAYLGLHDQSKRSAP
GVQERRIKRIISHPAFNDFTFDYDIALLELQQPAEYSGTVRPICLPGVSHAFPAGKAIWV
TGWGHTQEGGTTALILQKGEIRVINQTTCEKLLPQQITPRMMCVGYLSGGVDACQGDSGG
PLSSVEEDGRIFQAGVVSWGDGCAQRDKPGVYTRLPVFRDWIKEQTGV
Download sequence
Identical sequences F7BW05
ENSECAP00000005022 ENSECAP00000005022 9796.ENSECAP00000005022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]