SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005045 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005045
Domain Number 1 Region: 317-480
Classification Level Classification E-value
Superfamily vWA-like 0.0000000024
Family Integrin A (or I) domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005045   Gene: ENSECAG00000006633   Transcript: ENSECAT00000006986
Sequence length 891
Comment pep:known chromosome:EquCab2:20:31521031:31529774:-1 gene:ENSECAG00000006633 transcript:ENSECAT00000006986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLEESLSHLGPSVLLLLQLLLPPASAFFPNIWSLLAAPGSITHQDLTEEAALNVTLQL
FLEQPPPGRPPLHLEDFLGRTLLADDLFAAYFGPGFPSRRFRAALGEVSRANAAQDFLPT
SKNDPDLHFDAERLGQGHTRLVGALRETLVAARALDHTLARQRLGAALHALQDFYSHSNW
VELGKQQPHPHLLWPRRELGSLAQVGDPTCSDCEELSCPENLLGFTLLTSGYFGTHPPKP
PGKCSHGGHFDRSSSQPPRGGINKDSTSPGFSPHHMLHLQAAKLALLASIQAFSLLRSRL
GDSGFSRLLDISPASSLSFVLDTTGSMGEEINAAKIQARHIVEQRRGSPMEPVHYVLVPF
HDPGFGPVFTTSDPDSFWQQLNEIQALGGGDEPEMCLSALELALLHTPPLSDIFVFTDAS
PKDAFLTNRVESLTQERRCRVTFLVTEDPSRVQHRARREVLSPLRFEPYEAVALASGGEV
IFTKDQHIRDVAAIVGDSMADLVTLPLEPPVVVPGKPLVFIVDGLLQRLTVRIHGEVSSF
CIRNPAGVCQGQEEGEGPLGHTRRFGQFWMVTMNDPLQKGTWEIQVTAKGTPRVRVQAQT
SLDFLFYFGIPVEEGPHPGLYPLTQPVAGLQTQLLVEVTGLGSRGESGDPLPHFSHVVLR
GVPKGAELGRVPLEPMGPWERGLLAASLSPTLLSTAGPFSLELIGQDGGGQGLHRAAPQP
CSVVPVLLELSGPPGFLAPGTKAPLGLHIASFSGPQDLDLRASVNPSFALTSNLSRVLLE
HNESAWGRLWLEVPDSATPDSVVVVTVTAMGREASSVPPTHAFLRLLVLAPAPQDQLAAP
AHSSGPVLTTASPGFHPSTLVTRGIAGGGLAGNTWWGTVGGVLLLLGLASW
Download sequence
Identical sequences F7E3A3
ENSECAP00000005045 9796.ENSECAP00000005045 ENSECAP00000005045 XP_001491747.1.31192 XP_005603806.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]