SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005065 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005065
Domain Number 1 Region: 1-27,56-119
Classification Level Classification E-value
Superfamily CalX-like 0.000000000105
Family CalX-beta domain 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005065   Gene: ENSECAG00000006851   Transcript: ENSECAT00000007012
Sequence length 365
Comment pep:known chromosome:EquCab2:15:57957683:58019843:1 gene:ENSECAG00000006851 transcript:ENSECAT00000007012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTISVKVIDDEEYEKNKTFFLEIGEPCLVEMSEKKALLLNELGGFTITGQPVFRKVHARE
HPIPSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDK
LIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVFWKVL
FAFVPPTEYWNGWACFIVSILMIGVLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVP
DTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLA
FSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYC
HIKGF
Download sequence
Identical sequences F7E2R2
9796.ENSECAP00000005065 ENSECAP00000005065 ENSECAP00000005065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]