SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005088 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005088
Domain Number 1 Region: 377-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 215-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 334-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 179-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family EGF-type module 0.046
Further Details:      
 
Domain Number 5 Region: 258-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000703
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005088
Domain Number - Region: 297-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0125
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 535-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0476
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005088   Gene: ENSECAG00000007002   Transcript: ENSECAT00000007043
Sequence length 618
Comment pep:known chromosome:EquCab2:20:57990984:58137510:-1 gene:ENSECAG00000007002 transcript:ENSECAT00000007043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKSVMLLSLVVLHSTVINGKMTCKWQLVEEWHTQPSSYVVNWTLSENICTDFYGDCWF
GDVNTKMSTLGNQVVPQICPLQIQLGDILVISSEPSLQSPEINLMNVSEASFIDCMQNAT
TEDQLLFGCKLKGMHTVNSQWLSVGTHYFITVMANGPSLCQLGLRLNVTVKEQFCQEPLH
SEFCSGHGKCLSEVWSKVYSCHCQPPFSGKYCQEVDACSHKPCENNGSCINKRGKWNKQG
YECICHPPFTGINCSEIIDQCQPYVCFHGNYSNITTNSFICECDEPFSGPFCEESKKYCI
SQSFWKEGICQNKSLACIFECPEGFLNQSCETDVNECSVRCQDGADCIDIPNEIMCICST
AFTGKLCKRLQTPREQFPCKNNATCVKYEKDYHCSCLPGFTGKNCEKVIDHCRLLCVNCQ
NEGWCFNIIGRFRNACSPECMRNSCWFLKNVCLNHLYPCYCRAASHDICPAKVPHPQFKH
VWQLGLTGSECEKCEVAVDPCVFLAANCTEDAVYRNKSEDVGYEQWFLCEGTMEICANGS
LTEEDNKTYWCLCMPRWPGKMFMENTTDYEESGCQHETTHKDEINRSSLHLNAQIAQQTQ
QHMKSIIHHDQVGFITGM
Download sequence
Identical sequences F7DYR8
ENSECAP00000005088 ENSECAP00000005088 9796.ENSECAP00000005088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]