SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005171 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005171
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-126
Family Transglutaminase core 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily E set domains 2.76e-42
Family Transglutaminase N-terminal domain 0.000000768
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.97e-34
Family Transglutaminase, two C-terminal domains 0.00000156
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005171
Domain Number - Region: 586-615
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00249
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005171   Gene: ENSECAG00000006290   Transcript: ENSECAT00000007145
Sequence length 697
Comment pep:known chromosome:EquCab2:22:28370167:28401025:-1 gene:ENSECAG00000006290 transcript:ENSECAT00000007145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVDLILGRCDLELEANGRDHYTADLCRERLVVRRGQPFRVTLHFEGRNYEASVDSLTFS
VVTGPAPSEEAGTKARFPLSDAVDEGAWTALVVDQQDSALSLQLSTPANAPIGLYRLSLE
ASTGYEGSSFVLGHFTLLFNPWCPADAVYLDSEQEREEYVLTQQGFIYQGSAKFIKGIPW
NFGQFEDGILDICLMLLDINPKFLRDASRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKSCGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQKDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSLHKSVNRSL
VVGLQISTKSVGRDEREDITHNYKYPEGSPEEREAFTRANHLNKLADKEETGIAMRIRVS
QSMSMGSDFDVFAYITNNTAEDHACRLLLCARTVSYNGVLGPECGAKDLLNLSLEPFSEK
SIPLRILYKKYCDCLTESNLIKVRGLLIEPAANNYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPAGRAPVGLHLHRGGGGPDRGAEDHGDPGPSGGRAGSEGEGGPAAAARG
TPQAGGELRERQAESCEGFQERHHRPLLRGPQPHVSR
Download sequence
Identical sequences F7DA17
9796.ENSECAP00000005171 ENSECAP00000005171 ENSECAP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]