SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005294 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005294
Domain Number 1 Region: 312-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 2 Region: 248-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000226
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 498-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000212
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 651-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 614-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 212-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 536-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 172-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.017
Further Details:      
 
Domain Number 9 Region: 689-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000382
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 577-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000572
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005294
Domain Number - Region: 463-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 288-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0576
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005294   Gene: ENSECAG00000006609   Transcript: ENSECAT00000007287
Sequence length 1102
Comment pep:known chromosome:EquCab2:24:46373576:46389399:-1 gene:ENSECAG00000006609 transcript:ENSECAT00000007287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVR
CDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCA
VPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCNKDLNYCGSHHPC
TNGGTCINAEPDQYRCACPDGYSGKNCERAEHACTSNPCANGGSCHEVPSGFECHCPSGW
SGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFS
CKNLIGGYYCDCIPGWKGVNCHININDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCER
ELDECASSPCRGGLCEDLVDGFRCHCPKGFSGPLCEVDIDFCEPNPCQNGARCYNLEGDY
YCACPDDVGGKNCSVPREPCPGGACRVIDGCGFEAGPRVPGTALSSVCGPHGHCVSQPGG
NFSCVCDSGFTGTYCHENIDDCLGQPCLNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDC
LPDPCHSRGRCHDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCAC
PPGWRGSTCHIAENSSCLPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPC
YNGGICVDGVNWFRCECAPGFAGPDCRINVDECQSSPCAYGATCVDEINGYRCSCPPGRA
PRCQEVIVFGRSCWSQGVPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGQKPCLLAGRPDT
LSAQCPPGQQCQEKAPGQCLQPPCAAWGECGTEETLLPSTRCLPRSGHLDNNCARLTLRF
KHDQVPQGTTVGAICSGIRALPATRAVARDRLLILLCDRPSSGTSAVEVALSFSPARDLP
DSSLIQSAAHAIVAAITQRGNSSLLLAVTEVKVETVVMGVSSTGLLVPVLCGVFSVLCLA
CVVICVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIERPGGGAGGPKDVLYQCKN
FTPPPRRAGEALPGPAGGGDEDEDEEPGRGEADPLEAEKFLSHKFTKDPGCSPGRPARWA
SGPKVDNRAVRSVHDGHRAGKE
Download sequence
Identical sequences F7CGM0
ENSECAP00000005294 ENSECAP00000005294 9796.ENSECAP00000005294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]