SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005298 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005298
Domain Number 1 Region: 241-443
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 7.85e-31
Family Sec63 N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 101-203
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-25
Family Chaperone J-domain 0.00091
Further Details:      
 
Domain Number 3 Region: 454-479,634-718
Classification Level Classification E-value
Superfamily E set domains 2.1e-24
Family Sec63 C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005298   Gene: ENSECAG00000006392   Transcript: ENSECAT00000007291
Sequence length 760
Comment pep:known chromosome:EquCab2:10:57833217:57900062:-1 gene:ENSECAG00000006392 transcript:ENSECAT00000007291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFQYDDSGNTFFYFLTSFVGLIILFKAFYVWPRQHIVKQIRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALFLFLVYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSKPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPSLLQEMVNVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIHDLVSLKESDR
HNLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGDTNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVP
LSQSKQQKQKQANGVVGSEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAVEGDEDQEDSEGFEDSFEEEEEEEEDDD
Download sequence
Identical sequences F7CGJ3
9796.ENSECAP00000005298 ENSECAP00000005298 ENSECAP00000005298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]