SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005425 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005425
Domain Number 1 Region: 30-522
Classification Level Classification E-value
Superfamily Sema domain 1.96e-178
Family Sema domain 0.0000000000408
Further Details:      
 
Domain Number 2 Region: 518-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000488
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 592-673
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000108
Family V set domains (antibody variable domain-like) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005425   Gene: ENSECAG00000007183   Transcript: ENSECAT00000007432
Sequence length 776
Comment pep:known chromosome:EquCab2:4:28028516:28278698:-1 gene:ENSECAG00000007183 transcript:ENSECAT00000007432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGHIVTWLLWGYLLELWTGGHTADTTHPRLRLSHKELLDLNRTSIFHSPFGFLDLHT
MLLDEYQERLFVGGKDLIYSLSLEQINNGYREIHWPSTALKVEECIMKGKDTSECANYVR
VLHHYNRTHLLTCGTGAFDPLCAFIRVGYHLEDPLFHLESHRWERGRGRCPFDPSSSFTS
TLIGSELFTGLYSDYWGRDAAIFRSLGRLAHIRTEHDDERLLREPKFVGSHMIPDNEDGD
DNKVYFFFTEKALEAESNAHAIYSRVGRLCVNDVGGQRMLVNKWSTFLKARLVCSVPGMN
GIDTYFDELEDVFLLYTRDHKNPVIFGLFNTTSNIFRGHAVCVYHMSSIRAAFNGPYAHK
EGPEYHWTLYEGKVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFVRSHPLMYQPIKPAHK
KPILVKTDGKYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQETESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSTSTVAQVRFHQCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGSTHAKRRFRRQDVRHGDAAQQCFGQQFVGDALDKTEERLAYGIENNSTL
LECTPRSLQAKVMWSVQKGHDTRKEEVKTDDRVVKMDLGLLFLRVRKMDAGTYFCQTVEH
SFVHTVRKVTLEVVEEERVEEMFHKDYEEDGPHKMPCPAQSSIPQGVKPWYKEFLQLIGY
SNFQRVEEYCEKVWCTEKKRKKLKMSPSKWKYANTQEKKLRPKAEHYRLPRHTLDS
Download sequence
Identical sequences F7DIP3
9796.ENSECAP00000005425 ENSECAP00000005425 ENSECAP00000005425 XP_001491112.3.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]