SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005467 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005467
Domain Number 1 Region: 450-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-74
Family Protein kinases, catalytic subunit 0.00000026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005467
Domain Number - Region: 353-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0774
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005467   Gene: ENSECAG00000007080   Transcript: ENSECAT00000007478
Sequence length 769
Comment pep:known chromosome:EquCab2:15:66716347:67455084:1 gene:ENSECAG00000007080 transcript:ENSECAT00000007478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNTAPKSRNLFERNSNKESKPWENTPGETPIFDPTVHWLFTTCGASGPHGPTQAQCNN
AYRNSNLSVVVGSEGPLKGIQTWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIF
NLEKDDMLYILVGQQGEDACPSVSAQSRAWFLAQWAALEQGAALSKSEGVGGGARRWAGG
GGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAA
GGGGGWNDNTSLLWSGKSLLEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGY
IGGNAASDNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHM
DPESHKIICFCDHGTVLAEDGVSCIVLLKPPHLPLSLILSVVTSALVAALVLAFSGIMIG
EWRWQHLQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLI
RGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNI
VRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPSSLAMLDLLHVAQDIACGCQY
LEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPE
AFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVY
RIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPLVEEE
Download sequence
Identical sequences F7DDR7
ENSECAP00000005467 9796.ENSECAP00000005467 ENSECAP00000005467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]