SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005532 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005532
Domain Number 1 Region: 3-306
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.8e-48
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 
Domain Number 2 Region: 394-479
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000863
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005532
Domain Number - Region: 329-362
Classification Level Classification E-value
Superfamily Plexin repeat 0.0235
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005532   Gene: ENSECAG00000007459   Transcript: ENSECAT00000007554
Sequence length 483
Comment pep:known chromosome:EquCab2:6:58914027:59246923:-1 gene:ENSECAG00000007459 transcript:ENSECAT00000007554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLKRQLSLDALWQEMLVSSTVGAAAVSALAGGALNGVCGRRAAILLASALFTAGSTVL
AAATNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASV
VDGAFSYLQKDGWRYMLGLAAIPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGN
QTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIM
YYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVAL
IILALGFLLSAQVSPPITFKPIAPSGQNATCTRYSYCDECMLDPDCGFCYKMNKSTVIDS
SCVPVNKASTNAAAWGRCENETKFKTEEVFWAYNFCPTPYSWTALLGLILYLVFFAPGMG
PMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYVSFFLYKVFFTS
GFL
Download sequence
Identical sequences F7CRA1
9796.ENSECAP00000005532 ENSECAP00000005532 ENSECAP00000005532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]