SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005592 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005592
Domain Number 1 Region: 39-220
Classification Level Classification E-value
Superfamily vWA-like 5.4e-37
Family Integrin A (or I) domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005592   Gene: ENSECAG00000007023   Transcript: ENSECAT00000007618
Sequence length 564
Comment pep:known chromosome:EquCab2:15:33135619:33350957:-1 gene:ENSECAG00000007023 transcript:ENSECAT00000007618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVEQKALGIGFKCLSLATFVLICAGQGGRREEGGPACYGGFDLYFILDKSGSVLHHWN
EIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYM
HEGFQRASEQIYYENSQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGV
KDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVV
VRGNGFRHARNVDRVLCSFKINESVTLNEKPFAVEDTYLLCPAPILKEVGMKAALQVSMN
DGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPPAE
ESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKM
PEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGR
CVNFTRVKNNPPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTL
PPPPQAPPPNRAPPPSRPPPRPFC
Download sequence
Identical sequences F7CFZ8
ENSECAP00000005592 9796.ENSECAP00000005592 ENSECAP00000005592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]