SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005626 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005626
Domain Number 1 Region: 44-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000145
Family EGF-type module 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005626   Gene: ENSECAG00000007588   Transcript: ENSECAT00000007654
Sequence length 148
Comment pep:known chromosome:EquCab2:3:61440670:61445711:-1 gene:ENSECAG00000007588 transcript:ENSECAT00000007654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGFHLLQAVLSTTVIPSCIPGESEDNCTALVQTENNPRVAQVSITKCSSDMNGYCLHGQC
IFLVDMNENYCRCEVGYTGVRCEHFFLTVQQPLSKEYVALTVILVILFLVIVAGSIYYFC
RWYRNQKSKESKKEYERVTSGDPALPQV
Download sequence
Identical sequences F7BZ15
9796.ENSECAP00000005626 ENSECAP00000005626 ENSECAP00000005626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]